Lineage for d3dqzc_ (3dqz C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2509433Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2509434Protein automated matches [190543] (124 species)
    not a true protein
  7. 2510596Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (22 PDB entries)
  8. 2510629Domain d3dqzc_: 3dqz C: [174197]
    automated match to d1xkla_
    complexed with cl

Details for d3dqzc_

PDB Entry: 3dqz (more details), 2.5 Å

PDB Description: structure of the hydroxynitrile lyase from arabidopsis thaliana
PDB Compounds: (C:) Alpha-hydroxynitrile lyase-like protein

SCOPe Domain Sequences for d3dqzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqzc_ c.69.1.0 (C:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
pqklfdslsaiatdym

SCOPe Domain Coordinates for d3dqzc_:

Click to download the PDB-style file with coordinates for d3dqzc_.
(The format of our PDB-style files is described here.)

Timeline for d3dqzc_: