Lineage for d3dqzb_ (3dqz B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1384148Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 1384149Protein automated matches [190543] (40 species)
    not a true protein
  7. 1384378Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (1 PDB entry)
  8. 1384380Domain d3dqzb_: 3dqz B: [174196]
    automated match to d1xkla_
    complexed with cl

Details for d3dqzb_

PDB Entry: 3dqz (more details), 2.5 Å

PDB Description: structure of the hydroxynitrile lyase from arabidopsis thaliana
PDB Compounds: (B:) Alpha-hydroxynitrile lyase-like protein

SCOPe Domain Sequences for d3dqzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqzb_ c.69.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl
ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky
mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte
dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk
pqklfdslsaiatdy

SCOPe Domain Coordinates for d3dqzb_:

Click to download the PDB-style file with coordinates for d3dqzb_.
(The format of our PDB-style files is described here.)

Timeline for d3dqzb_: