Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (40 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188958] (1 PDB entry) |
Domain d3dqzb_: 3dqz B: [174196] automated match to d1xkla_ complexed with cl |
PDB Entry: 3dqz (more details), 2.5 Å
SCOPe Domain Sequences for d3dqzb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dqzb_ c.69.1.0 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} rkhhfvlvhnayhgawiwyklkpllesaghrvtavelaasgidprpiqavetvdeyskpl ietlkslpeneevilvgfsfgginialaadifpakikvlvflnaflpdtthvpshvldky mempgglgdcefsshetrngtmsllkmgpkfmkarlyqncpiedyelakmlhrqgsffte dlskkekfseegygsvqrvyvmssedkaipcdfirwmidnfnvskvyeidggdhmvmlsk pqklfdslsaiatdy
Timeline for d3dqzb_: