Class a: All alpha proteins [46456] (258 folds) |
Fold a.42: SWIB/MDM2 domain [47591] (1 superfamily) core: 4 helices: open bundle; capped by two small 3-stranded beta-sheets duplication: consists of two structural repeats |
Superfamily a.42.1: SWIB/MDM2 domain [47592] (1 family) binds to the transactivation domain of human p53 |
Family a.42.1.1: SWIB/MDM2 domain [47593] (4 proteins) Pfam PF02201 |
Protein MDM2 [47594] (2 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47595] (2 PDB entries) |
Domain d1ycqa_: 1ycq A: [17419] |
PDB Entry: 1ycq (more details), 2.3 Å
SCOP Domain Sequences for d1ycqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycqa_ a.42.1.1 (A:) MDM2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} eklvqptplllsllksagaqketftmkeviyhlgqyimakqlydekqqhivhcsndplge lfgvqefsvkeprrlyamisrnlvsanv
Timeline for d1ycqa_: