Lineage for d3dqqb_ (3dqq B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152074Fold c.146: YgbK-like [142763] (1 superfamily)
    consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands
  4. 2152075Superfamily c.146.1: YgbK-like [142764] (2 families) (S)
  5. 2152076Family c.146.1.1: YgbK-like [142765] (2 protein domains)
    Pfam PF07005; DUF1537; the B-fam model-covered region is non-compact in structure and distributed between the two domains
  6. 2152081Protein automated matches [190941] (1 species)
    not a true protein
  7. 2152082Species Salmonella typhimurium [TaxId:90371] [188501] (1 PDB entry)
  8. 2152084Domain d3dqqb_: 3dqq B: [174186]
    Other proteins in same PDB: d3dqqa2
    automated match to d1yzya1

Details for d3dqqb_

PDB Entry: 3dqq (more details), 2.7 Å

PDB Description: The crystal structure of the putative tRNA synthase from Salmonella typhimurium LT2
PDB Compounds: (B:) Putative tRNA synthase

SCOPe Domain Sequences for d3dqqb_:

Sequence, based on SEQRES records: (download)

>d3dqqb_ c.146.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqea
ikqslaalvwlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvn
grtvyqgylfvmnhllaesgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaa
traalsrlqqegyryavldalnerhleiqgevlrdaplvtggsglamglarqwakhgvsq
arsagyplsgravvlsgscsqmtnqqvafyrqhaptrdvdvarclssetreayaealaqw
vlsqdselapmisatastqalaaiqqqygateashavealfsllaarlaeggitrfivag
getsgvvtqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffiraqrefq

Sequence, based on observed residues (ATOM records): (download)

>d3dqqb_ c.146.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqea
ikqslaalvwlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvn
grtvyqgylfvmnhllaesgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaa
traalsrlqqegyryavldalnerhleiqgevlrdaplvtggsglamglarqwaksagyp
lsgravvlsgscsqmtnqqvafyrqhaptrdvdvarclssetreayaealaqwvlsqdse
lapmisatastqalaaiqqqygateashavealfsllaarlaeggitrfivaggetsgvv
tqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffiraqrefq

SCOPe Domain Coordinates for d3dqqb_:

Click to download the PDB-style file with coordinates for d3dqqb_.
(The format of our PDB-style files is described here.)

Timeline for d3dqqb_: