![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.146: YgbK-like [142763] (1 superfamily) consists of two domains with partial topological similarity to the P-loop kinases but without the P-loop motif; the domain association results in the formation of a single mixed beta-sheet of 15 strands |
![]() | Superfamily c.146.1: YgbK-like [142764] (2 families) ![]() |
![]() | Family c.146.1.1: YgbK-like [142765] (2 proteins) Pfam PF07005; DUF1537; the B-fam model-covered region is non-compact in structure and distributed between the two domains |
![]() | Protein automated matches [190941] (1 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:90371] [188501] (1 PDB entry) |
![]() | Domain d3dqqb_: 3dqq B: [174186] Other proteins in same PDB: d3dqqa2 automated match to d1yzya1 |
PDB Entry: 3dqq (more details), 2.7 Å
SCOPe Domain Sequences for d3dqqb_:
Sequence, based on SEQRES records: (download)
>d3dqqb_ c.146.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqea ikqslaalvwlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvn grtvyqgylfvmnhllaesgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaa traalsrlqqegyryavldalnerhleiqgevlrdaplvtggsglamglarqwakhgvsq arsagyplsgravvlsgscsqmtnqqvafyrqhaptrdvdvarclssetreayaealaqw vlsqdselapmisatastqalaaiqqqygateashavealfsllaarlaeggitrfivag getsgvvtqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffiraqrefq
>d3dqqb_ c.146.1.1 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]} mlkigviaddftgatdiasflvengmptvqindvptgtqpegcdavvislktrscpaqea ikqslaalvwlkkqgcqqvyfkycstfdstaegnigpvtdalmvaldtsftvispalpvn grtvyqgylfvmnhllaesgmrhhpinpmtdsylprlmeaqaqgrcgvipaqtldegvaa traalsrlqqegyryavldalnerhleiqgevlrdaplvtggsglamglarqwaksagyp lsgravvlsgscsqmtnqqvafyrqhaptrdvdvarclssetreayaealaqwvlsqdse lapmisatastqalaaiqqqygateashavealfsllaarlaeggitrfivaggetsgvv tqslgitgfhigpcispgvpwvnalhapvslalksgnfgdesffiraqrefq
Timeline for d3dqqb_: