Lineage for d3dqla_ (3dql A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1021954Protein Green fluorescent protein, GFP [54513] (4 species)
  7. 1021960Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (118 PDB entries)
    Uniprot P42212
  8. 1022010Domain d3dqla_: 3dql A: [174181]
    automated match to d1huya_

Details for d3dqla_

PDB Entry: 3dql (more details), 1.47 Å

PDB Description: structure of the yellow fluorescent protein citrine frozen at 1000 atmospheres number 1: structure 5 in a series of 26 high pressure structures
PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3dqla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dqla_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
dpmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpw
ptlvttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegd
tlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvq
ladhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d3dqla_:

Click to download the PDB-style file with coordinates for d3dqla_.
(The format of our PDB-style files is described here.)

Timeline for d3dqla_: