SCOPe 2.01: Domain d3dqla_: 3dql A:

Lineage for d3dqla_ (3dql A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (118 PDB entries)
   Uniprot P42212

8. Domain d3dqla_: 3dql A: [174181]
   automated match to d1huya_

Details for d3dqla_

PDB Entry: 3dql, 1.47 Å

PDB Description: structure of the yellow fluorescent protein citrine frozen at 1000 atmospheres number 1: structure 5 in a series of 26 high pressure structures

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3dqla_:

Sequence; same for both SEQRES and ATOM records:

>d3dqla_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
dpmvskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpw
ptlvttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegd
tlvnrielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvq
ladhyqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d3dqla_:

• d3dqla_ is new in SCOPe 2.01-stable
  
• d3dqla_ appears in SCOPe 2.02
  
• d3dqla_ appears in the current release, SCOPe 2.08, called d3dqla1