SCOPe 2.06: Domain d3dq8a1: 3dq8 A:2-230

Lineage for d3dq8a1 (3dq8 A:2-230)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d3dq8a1: 3dq8 A:2-230 [174170]
   Other proteins in same PDB: d3dq8a2
   automated match to d1huya_

Details for d3dq8a1

PDB Entry: 3dq8, 1.51 Å

PDB Description: structure of the yellow fluorescent protein citrine frozen at 1500 atmospheres number 2: structure 16 in a series of 26 high pressure structures

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d3dq8a1:

Sequence; same for both SEQRES and ATOM records:

>d3dq8a1 d.22.1.1 (A:2-230) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfgyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvn
rielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladh
yqqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagit

Timeline for d3dq8a1:

• d3dq8a1 first appeared in SCOPe 2.01, called d3dq8a_
  
• d3dq8a1 was called d3dq8a_ in SCOPe 2.05
  
• d3dq8a1 appears in SCOPe 2.07
  
• d3dq8a1 appears in the current release, SCOPe 2.08