Lineage for d2pawa1 (2paw A:662-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325365Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 2325366Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 2325367Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)
  8. 2325372Domain d2pawa1: 2paw A:662-796 [17417]
    Other proteins in same PDB: d2pawa2

Details for d2pawa1

PDB Entry: 2paw (more details), 2.3 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase
PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d2pawa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pawa1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus) [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

SCOPe Domain Coordinates for d2pawa1:

Click to download the PDB-style file with coordinates for d2pawa1.
(The format of our PDB-style files is described here.)

Timeline for d2pawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pawa2