Lineage for d1pax_1 (1pax 662-796)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) 
Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein) Protein Domain of poly(ADP-ribose) polymerase [47589] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries) 
Domain d1pax_1: 1pax 662-796 [17416]
Other proteins in same PDB: d1pax_2
Details for d1pax_1
PDB Entry: 1pax (more details), 2.4 Å
PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 3,4-dihydro-5-methyl-isoquinolinone
SCOP Domain Sequences for d1pax_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pax_1 a.41.1.1 (662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus)}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek
SCOP Domain Coordinates for d1pax_1:
Click to download the PDB-style file with coordinates for d1pax_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pax_1:
- d1pax_1 appears in SCOP 1.57
- d1pax_1 appears in the current release, SCOPe 2.08, called d1paxa1
View in 3D
