| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
| Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins) |
| Protein Neutrophil collagenase (MMP-8) [55532] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries) |
| Domain d3dpfb_: 3dpf B: [174154] automated match to d1i73a_ complexed with axb, ca, hae, zn |
PDB Entry: 3dpf (more details), 2.1 Å
SCOPe Domain Sequences for d3dpfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dpfb_ d.92.1.11 (B:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg
Timeline for d3dpfb_: