Lineage for d3dpcb_ (3dpc B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1181860Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 1181861Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 1181862Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
  6. 1181954Protein automated matches [190176] (2 species)
    not a true protein
  7. 1181955Species Escherichia coli K-12 [TaxId:83333] [188893] (2 PDB entries)
  8. 1181961Domain d3dpcb_: 3dpc B: [174151]
    automated match to d1ajaa_
    complexed with po4, trs; mutant

Details for d3dpcb_

PDB Entry: 3dpc (more details), 2.3 Å

PDB Description: structure of e.coli alkaline phosphatase mutant in complex with a phosphorylated peptide
PDB Compounds: (B:) alkaline phosphatase

SCOPe Domain Sequences for d3dpcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dpcb_ c.76.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaa
rnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngalg
vdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgn
alekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaa
slnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaq
mtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegn
tlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaa
ygphaanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d3dpcb_:

Click to download the PDB-style file with coordinates for d3dpcb_.
(The format of our PDB-style files is described here.)

Timeline for d3dpcb_: