Lineage for d3dpca1 (3dpc A:2-449)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905606Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 2905607Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 2905608Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 2905609Protein Alkaline phosphatase [53651] (4 species)
  7. 2905610Species Escherichia coli K-12 [TaxId:83333] [224910] (2 PDB entries)
  8. 2905615Domain d3dpca1: 3dpc A:2-449 [174150]
    Other proteins in same PDB: d3dpca2
    automated match to d1ajaa_
    complexed with po4, trs; mutant

Details for d3dpca1

PDB Entry: 3dpc (more details), 2.3 Å

PDB Description: structure of e.coli alkaline phosphatase mutant in complex with a phosphorylated peptide
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d3dpca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dpca1 c.76.1.1 (A:2-449) Alkaline phosphatase {Escherichia coli K-12 [TaxId: 83333]}
pempvlenraaqgditapggarrltgdqtaalrdslsdkpakniilligdgmgdseitaa
rnyaegaggffkgidalpltgqythyalnkktgkpdyvtdlaasatawstgvktyngalg
vdihekdhptilemakaaglatgnvstaelqdatpaalvahvtsrkcygpsatsekcpgn
alekggkgsiteqllnaradvtlgggaktfaetatagewqgktlreqaqargyqlvsdaa
slnsvteanqqkpllglfadgnmpvrwlgpkatyhgnidkpavtctpnpqrndsvptlaq
mtdkaiellsknekgfflqvegasidkqdhaanpcgqigetvdldeavqralefakkegn
tlvivtadhahasqivapdtkapgltqalntkdgavmvmsygnseedsqehtgsqlriaa
ygphaanvvgltdqtdlfytmkaalglk

SCOPe Domain Coordinates for d3dpca1:

Click to download the PDB-style file with coordinates for d3dpca1.
(The format of our PDB-style files is described here.)

Timeline for d3dpca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dpca2
View in 3D
Domains from other chains:
(mouse over for more information)
d3dpcb_