SCOP 1.65: Domain d3pax_1: 3pax 662-796

Lineage for d3pax_1 (3pax 662-796)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family)
   duplication: consists of 2 helix-loop-helix structural repeats

5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)

6. Protein Domain of poly(ADP-ribose) polymerase [47589] (2 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)

8. Domain d3pax_1: 3pax 662-796 [17415]
   Other proteins in same PDB: d3pax_2
   complexed with 3mb

Details for d3pax_1

PDB Entry: 3pax, 2.4 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 3-methoxybenzamide

SCOP Domain Sequences for d3pax_1:

Sequence; same for both SEQRES and ATOM records:

>d3pax_1 a.41.1.1 (662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus)}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

Timeline for d3pax_1:

• d3pax_1 first appeared (with stable ids) in SCOP 1.55
  
• d3pax_1 appears in SCOP 1.63
  
• d3pax_1 appears in SCOP 1.67
  
• d3pax_1 appears in the current release, SCOPe 2.08, called d3paxa1