Lineage for d3dpbc_ (3dpb C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 938438Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 938566Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 938571Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 938665Protein automated matches [190569] (5 species)
    not a true protein
  7. 938681Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)
  8. 938683Domain d3dpbc_: 3dpb C: [174149]
    automated match to d1p5ub_
    mutant

Details for d3dpbc_

PDB Entry: 3dpb (more details), 2.2 Å

PDB Description: Crystal structure of the complex of the Caf1M chaperone with the mini-fiber of two Caf1 subunits (Caf1:Caf1), carrying the Ala9Val, Ala11Val, and Leu13Val mutations in the Gd donor strand
PDB Compounds: (C:) F1 capsule antigen

SCOPe Domain Sequences for d3dpbc_:

Sequence, based on SEQRES records: (download)

>d3dpbc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaagky
tdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d3dpbc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]}
itltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltftsqd
gnnhqfttkvigkdsrdfdispkvngenldvvlatgsqdffvrsigskggklaagkytda
vtvtvsnq

SCOPe Domain Coordinates for d3dpbc_:

Click to download the PDB-style file with coordinates for d3dpbc_.
(The format of our PDB-style files is described here.)

Timeline for d3dpbc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dpbb_