| Class b: All beta proteins [48724] (174 folds) |
| Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
| Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
| Protein automated matches [190569] (7 species) not a true protein |
| Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries) |
| Domain d3dpbb_: 3dpb B: [174148] Other proteins in same PDB: d3dpba1, d3dpba2 automated match to d1p5ub_ mutant |
PDB Entry: 3dpb (more details), 2.2 Å
SCOPe Domain Sequences for d3dpbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dpbb_ b.2.3.2 (B:) automated matches {Yersinia pestis [TaxId: 632]}
adltasttvtvtvveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq
Timeline for d3dpbb_: