SCOPe 2.08: Domain d3dpbb_: 3dpb B:

Lineage for d3dpbb_ (3dpb B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (11 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)

8. Domain d3dpbb_: 3dpb B: [174148]
   Other proteins in same PDB: d3dpba1, d3dpba2
   automated match to d1p5ub_
   mutant

Details for d3dpbb_

PDB Entry: 3dpb, 2.2 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the ala9val, ala11val, and leu13val mutations in the gd donor strand

PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d3dpbb_:

Sequence; same for both SEQRES and ATOM records:

>d3dpbb_ b.2.3.2 (B:) automated matches {Yersinia pestis [TaxId: 632]}
adltasttvtvtvveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

Timeline for d3dpbb_:

• d3dpbb_ first appeared in SCOPe 2.01
  
• d3dpbb_ appears in SCOPe 2.07