Lineage for d3dp4a_ (3dp4 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2485906Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2485907Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2485908Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2486861Protein automated matches [190140] (32 species)
    not a true protein
  7. 2486975Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)
  8. 2487020Domain d3dp4a_: 3dp4 A: [174141]
    automated match to d1lbcb_
    complexed with amq, zn

Details for d3dp4a_

PDB Entry: 3dp4 (more details), 2.11 Å

PDB Description: crystal structure of the binding domain of the ampa subunit glur3 bound to ampa
PDB Compounds: (A:) Glutamate receptor 3

SCOPe Domain Sequences for d3dp4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dp4a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
qgildklknkwwydkgec

SCOPe Domain Coordinates for d3dp4a_:

Click to download the PDB-style file with coordinates for d3dp4a_.
(The format of our PDB-style files is described here.)

Timeline for d3dp4a_: