SCOPe 2.08: Domain d3dp4a_: 3dp4 A:

Lineage for d3dp4a_ (3dp4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (36 PDB entries)

8. Domain d3dp4a_: 3dp4 A: [174141]
   automated match to d1lbcb_
   complexed with amq, zn

Details for d3dp4a_

PDB Entry: 3dp4, 2.11 Å

PDB Description: crystal structure of the binding domain of the ampa subunit glur3 bound to ampa

PDB Compounds: (A:) Glutamate receptor 3

SCOPe Domain Sequences for d3dp4a_:

Sequence; same for both SEQRES and ATOM records:

>d3dp4a_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
qgildklknkwwydkgec

Timeline for d3dp4a_:

• d3dp4a_ first appeared in SCOPe 2.01
  
• d3dp4a_ appears in SCOPe 2.07