SCOPe 2.08: Domain d2paxa1: 2pax A:662-796

Lineage for d2paxa1 (2pax A:662-796)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
   core: 4 helices: bundle; unusual topology

4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families)
   duplication: consists of 2 helix-loop-helix structural repeats
   automatically mapped to Pfam PF02877

5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)

6. Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)

8. Domain d2paxa1: 2pax A:662-796 [17414]
   Other proteins in same PDB: d2paxa2
   protein/DNA complex; complexed with 4an

Details for d2paxa1

PDB Entry: 2pax, 2.4 Å

PDB Description: the catalytic fragment of poly(adp-ribose) polymerase complexed with 4-amino-1,8-naphthalimide

PDB Compounds: (A:) poly(ADP-ribose) polymerase

SCOPe Domain Sequences for d2paxa1:

Sequence; same for both SEQRES and ATOM records:

>d2paxa1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus) [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

Timeline for d2paxa1:

• d2paxa1 first appeared (with stable ids) in SCOP 1.55, called d2pax_1
  
• d2paxa1 appears in SCOPe 2.07