Lineage for d3dp2f_ (3dp2 F:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1409951Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1409952Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1410402Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 1410403Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 1410404Species Helicobacter pylori [TaxId:210] [188573] (15 PDB entries)
  8. 1410452Domain d3dp2f_: 3dp2 F: [174134]
    automated match to d1u1za_
    complexed with 4be, ben, cl

Details for d3dp2f_

PDB Entry: 3dp2 (more details), 2.4 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with compound 3j
PDB Compounds: (F:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3dp2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dp2f_ d.38.1.6 (F:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
miwqvggtaqvdgkvvaeaelkamiaer

SCOPe Domain Coordinates for d3dp2f_:

Click to download the PDB-style file with coordinates for d3dp2f_.
(The format of our PDB-style files is described here.)

Timeline for d3dp2f_: