Lineage for d1efya1 (1efy A:662-796)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 47925Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
  4. 47926Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
  5. 47927Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 47928Protein Domain of poly(ADP-ribose) polymerase [47589] (1 species)
  7. 47929Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)
  8. 47931Domain d1efya1: 1efy A:662-796 [17413]
    Other proteins in same PDB: d1efya2

Details for d1efya1

PDB Entry: 1efy (more details), 2.2 Å

PDB Description: crystal structure of the catalytic fragment of poly (adp-ribose) polymerase complexed with a benzimidazole inhibitor

SCOP Domain Sequences for d1efya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efya1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus)}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

SCOP Domain Coordinates for d1efya1:

Click to download the PDB-style file with coordinates for d1efya1.
(The format of our PDB-style files is described here.)

Timeline for d1efya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efya2