Lineage for d1efya1 (1efy A:662-796)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. Species Chicken (Gallus gallus) [TaxId:9031] [47590] (7 PDB entries)
  8. Domain d1efya1: 1efy A:662-796 [17413]
    Other proteins in same PDB: d1efya2
    complexed with bzc

Details for d1efya1

PDB Entry: 1efy (more details), 2.2 Å

PDB Description: crystal structure of the catalytic fragment of poly (adp-ribose) polymerase complexed with a benzimidazole inhibitor
PDB Compounds: (A:) poly (ADP-ribose) polymerase

SCOPe Domain Sequences for d1efya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efya1 a.41.1.1 (A:662-796) Domain of poly(ADP-ribose) polymerase {Chicken (Gallus gallus) [TaxId: 9031]}
ksklakpiqdlikmifdvesmkkamvefeidlqkmplgklskrqiqsaysilnevqqavs
dggsesqildlsnrfytliphdfgmkkppllsnleyiqakvqmldnlldievaysllrgg
nedgdkdpidinyek

SCOPe Domain Coordinates for d1efya1 are not available.

Timeline for d1efya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1efya2