Lineage for d1dxxd2 (1dxx D:120-246)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 538206Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 538207Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 538208Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam 00307
  6. 538226Protein Dystrophin [47584] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 538227Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)
  8. 538235Domain d1dxxd2: 1dxx D:120-246 [17411]
    mutant

Details for d1dxxd2

PDB Entry: 1dxx (more details), 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin

SCOP Domain Sequences for d1dxxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxxd2 a.40.1.1 (D:120-246) Dystrophin {Human (Homo sapiens)}
vknvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpd
lfdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvl
pqqvsie

SCOP Domain Coordinates for d1dxxd2:

Click to download the PDB-style file with coordinates for d1dxxd2.
(The format of our PDB-style files is described here.)

Timeline for d1dxxd2: