Lineage for d1dxxd2 (1dxx D:120-246)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3533Fold a.40: Calponin-homology domain, CH-domain [47575] (1 superfamily)
  4. 3534Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 3535Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (4 proteins)
  6. 3540Protein Dystrophin [47584] (1 species)
  7. 3541Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)
  8. 3549Domain d1dxxd2: 1dxx D:120-246 [17411]

Details for d1dxxd2

PDB Entry: 1dxx (more details), 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin

SCOP Domain Sequences for d1dxxd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxxd2 a.40.1.1 (D:120-246) Dystrophin {Human (Homo sapiens)}
vknvmknimaglqqtnsekillswvrqstrnypqvnvinfttswsdglalnalihshrpd
lfdwnsvvsqqsatqrlehafniaryqlgieklldpedvdttypdkksilmyitslfqvl
pqqvsie

SCOP Domain Coordinates for d1dxxd2:

Click to download the PDB-style file with coordinates for d1dxxd2.
(The format of our PDB-style files is described here.)

Timeline for d1dxxd2: