SCOPe 2.04: Domain d3doyc_: 3doy C:

Lineage for d3doyc_ (3doy C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.6: FabZ-like [110902] (1 protein)
   automatically mapped to Pfam PF07977

6. Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)

7. Species Helicobacter pylori [TaxId:210] [188573] (15 PDB entries)

8. Domain d3doyc_: 3doy C: [174107]
   automated match to d1u1za_
   complexed with 2be, ben, cl

Details for d3doyc_

PDB Entry: 3doy, 2.4 Å

PDB Description: crystal structure of (3r)-hydroxyacyl-acyl carrier protein dehydratase (fabz) from helicobacter pylori in complex with compound 3i

PDB Compounds: (C:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3doyc_:

Sequence; same for both SEQRES and ATOM records:

>d3doyc_ d.38.1.6 (C:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaer

Timeline for d3doyc_:

• d3doyc_ first appeared in SCOPe 2.01
  
• d3doyc_ appears in SCOPe 2.03
  
• d3doyc_ appears in SCOPe 2.05
  
• d3doyc_ appears in the current release, SCOPe 2.08