Lineage for d3doua1 (3dou A:17-196)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (63 species)
    not a true protein
  7. 2130923Species Thermoplasma volcanium [TaxId:50339] [188579] (1 PDB entry)
  8. 2130924Domain d3doua1: 3dou A:17-196 [174103]
    Other proteins in same PDB: d3doua2
    automated match to d1eiza_
    complexed with sam

Details for d3doua1

PDB Entry: 3dou (more details), 1.45 Å

PDB Description: Crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase J

SCOPe Domain Sequences for d3doua1:

Sequence, based on SEQRES records: (download)

>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfka

Sequence, based on observed residues (ATOM records): (download)

>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskpsseiyimffgfka

SCOPe Domain Coordinates for d3doua1:

Click to download the PDB-style file with coordinates for d3doua1.
(The format of our PDB-style files is described here.)

Timeline for d3doua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3doua2