SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3doua1 (3dou A:17-196)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (58 species)
    not a true protein
  7. 2130923Species Thermoplasma volcanium [TaxId:50339] [188579] (1 PDB entry)
  8. 2130924Domain d3doua1: 3dou A:17-196 [174103]
    Other proteins in same PDB: d3doua2
    automated match to d1eiza_
    complexed with sam

Details for d3doua1

PDB Entry: 3dou (more details), 1.45 Å

PDB Description: Crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase J

SCOPe Domain Sequences for d3doua1:

Sequence, based on SEQRES records: (download)

>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfka

Sequence, based on observed residues (ATOM records): (download)

>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskpsseiyimffgfka

SCOPe Domain Coordinates for d3doua1:

Click to download the PDB-style file with coordinates for d3doua1.
(The format of our PDB-style files is described here.)

Timeline for d3doua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3doua2