SCOPe Funding Alert: SCOPe support from the NIH
ended in April 2016. John-Marc Chandonia is the primary
maintainer and has continued to develop SCOPe using vacation
time. Three proposals to the NIH for continued funding have been
unsuccessful. If our current NIH proposal is not funded,
SCOPe will shut down permanently in Summer 2017
as Dr. Chandonia will need to seek a new position.
Lineage for d3doua1 (3dou A:17-196)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) 
Family c.66.1.0: automated matches [191451] (1 protein)
not a true familyProtein automated matches [190689] (62 species)
not a true protein
Species Thermoplasma volcanium [TaxId:50339] [188579] (1 PDB entry) 
Domain d3doua1: 3dou A:17-196 [174103]
Other proteins in same PDB: d3doua2
automated match to d1eiza_
complexed with sam
Details for d3doua1
PDB Entry: 3dou (more details), 1.45 Å
PDB Description: Crystal structure of methyltransferase involved in cell division from thermoplasma volcanicum gss1
PDB Compounds: (A:) Ribosomal RNA large subunit methyltransferase JSCOPe Domain Sequences for d3doua1:
Sequence, based on SEQRES records: (download)
>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfka
Sequence, based on observed residues (ATOM records): (download)
>d3doua1 c.66.1.0 (A:17-196) automated matches {Thermoplasma volcanium [TaxId: 50339]}
qlrsraafkleflldryrvvrkgdavieigsspggwtqvlnslarkiisidlqemeeiag
vrfircdifketifddidralreegiekvddvvsdamakvsgipsrdhavsyqigqrvme
iavrylrnggnvllkqfqgdmtndfiaiwrknfssykiskpsseiyimffgfka
SCOPe Domain Coordinates for d3doua1:
Click to download the PDB-style file with coordinates for d3doua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3doua1:
- d3doua1 first appeared in SCOPe 2.01, called d3doua_
- d3doua1 was called d3doua_ in SCOPe 2.05
View in 3D
