SCOPe 2.07: Domain d3dosf_: 3dos F:

Lineage for d3dosf_ (3dos F:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.2: Pilus subunits [49405] (10 proteins)

6. Protein automated matches [190569] (9 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)

8. Domain d3dosf_: 3dos F: [174102]
   Other proteins in same PDB: d3dosa1, d3dosa2, d3dosd1, d3dosd2
   automated match to d1p5ub_
   mutant

Details for d3dosf_

PDB Entry: 3dos, 2.4 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe and ala9val mutations in the gd donor strand

PDB Compounds: (F:) F1 capsule antigen

SCOPe Domain Sequences for d3dosf_:

Sequence, based on SEQRES records:

>d3dosf_ b.2.3.2 (F:) automated matches {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggklaa
gkytdavtvtvsnq

Sequence, based on observed residues (ATOM records):

>d3dosf_ b.2.3.2 (F:) automated matches {Yersinia pestis [TaxId: 632]}
paritltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltft
sqdgnnhqfttkvigkdsrdfdispkvngengddvvlatgsqdffvrsigskggklaagk
ytdavtvtvsnq

Timeline for d3dosf_:

• d3dosf_ first appeared in SCOPe 2.01
  
• d3dosf_ appears in SCOPe 2.06
  
• d3dosf_ appears in the current release, SCOPe 2.08