Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (7 families) |
Family b.2.3.2: Pilus subunits [49405] (11 proteins) |
Protein automated matches [190569] (9 species) not a true protein |
Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries) |
Domain d3dosc_: 3dos C: [174100] Other proteins in same PDB: d3dosa1, d3dosa2, d3dosd1, d3dosd2 automated match to d1p5ub_ mutant |
PDB Entry: 3dos (more details), 2.4 Å
SCOPe Domain Sequences for d3dosc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dosc_ b.2.3.2 (C:) automated matches {Yersinia pestis [TaxId: 632]} eparitltykegapitimdngnidtellvgtltlggyktgttstsvnftdaagdpmyltf tsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqdffvrsigskggkla agkytdavtvtvsnq
Timeline for d3dosc_: