Lineage for d3dosb_ (3dos B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112704Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1112709Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1112822Protein automated matches [190569] (5 species)
    not a true protein
  7. 1112840Species Yersinia pestis [TaxId:632] [188957] (3 PDB entries)
  8. 1112847Domain d3dosb_: 3dos B: [174099]
    automated match to d1p5ub_
    mutant

Details for d3dosb_

PDB Entry: 3dos (more details), 2.4 Å

PDB Description: crystal structure of the complex of the caf1m chaperone with the mini- fiber of two caf1 subunits (caf1:caf1), carrying the thr7phe and ala9val mutations in the gd donor strand
PDB Compounds: (B:) F1 capsule antigen

SCOPe Domain Sequences for d3dosb_:

Sequence, based on SEQRES records: (download)

>d3dosb_ b.2.3.2 (B:) automated matches {Yersinia pestis [TaxId: 632]}
adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklaagkytdavtvtvsnq

Sequence, based on observed residues (ATOM records): (download)

>d3dosb_ b.2.3.2 (B:) automated matches {Yersinia pestis [TaxId: 632]}
adltasftvtatlveparitltykegapitimdngnidtellvgtltlggyktgttstsv
nftdaagdpmyltftsqdgnnhqfttkvigkdsrdfdispkvngenlvgddvvlatgsqd
ffvrsigskggklagkytdavtvtvsnq

SCOPe Domain Coordinates for d3dosb_:

Click to download the PDB-style file with coordinates for d3dosb_.
(The format of our PDB-style files is described here.)

Timeline for d3dosb_: