Lineage for d3do6b1 (3do6 B:1-542)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114779Species Thermotoga maritima [TaxId:2336] [188476] (7 PDB entries)
  8. 2114781Domain d3do6b1: 3do6 B:1-542 [174093]
    Other proteins in same PDB: d3do6a2, d3do6b2
    automated match to d1fp7a_
    complexed with edo

Details for d3do6b1

PDB Entry: 3do6 (more details), 1.85 Å

PDB Description: crystal structure of putative formyltetrahydrofolate synthetase (tm1766) from thermotoga maritima at 1.85 a resolution
PDB Compounds: (B:) Formate--tetrahydrofolate ligase

SCOPe Domain Sequences for d3do6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do6b1 c.37.1.0 (B:1-542) automated matches {Thermotoga maritima [TaxId: 2336]}
mkpikeiadqlelkddilypyghyiakidhrflkslenhedgklilvtavtptpagegkt
ttsiglsmslnrigkksivtlrepslgptlglkggatgggrsrvlpsdeinlhftgdmha
vasahnllaavldshikhgnelkiditrvfwkrtmdmndralrsiviglggsangfpred
sfiitaasevmailalsenmkdlkerlgkiivaldadrkivrisdlgiqgamavllkdai
npnlvqttegtpalihcgpfaniahgtnsiiatkmamklseytvteagfgadlgaekfid
fvsrvggfypnaavlvatvralkyhgganlkniheenlealkegfknlrvhvenlrkfnl
pvvvalnrfstdtekeiayvvkeceklgvrvavsevfkkgseggvelakavaeaakdvep
aylyemndpvekkieilakeiyragrvefsdtaknalkfikkhgfdelpvivaktpksis
hdpslrgapegytfvvsdlfvsagagfvvalsgdinlmpglpkkpnalnmdvddsgnivg
vs

SCOPe Domain Coordinates for d3do6b1:

Click to download the PDB-style file with coordinates for d3do6b1.
(The format of our PDB-style files is described here.)

Timeline for d3do6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3do6b2