Lineage for d3do4a_ (3do4 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939304Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 939305Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 939306Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 939327Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
    Uniprot P02766 31-143
  8. 939597Domain d3do4a_: 3do4 A: [174084]
    automated match to d1tsha_
    complexed with act

Details for d3do4a_

PDB Entry: 3do4 (more details), 2.4 Å

PDB Description: crystal structure of transthyretin variant t60a at acidic ph
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3do4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3do4a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltaeeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d3do4a_:

Click to download the PDB-style file with coordinates for d3do4a_.
(The format of our PDB-style files is described here.)

Timeline for d3do4a_: