Lineage for d3dnpa_ (3dnp A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920292Species Bacillus subtilis [TaxId:1423] [188499] (5 PDB entries)
  8. 2920298Domain d3dnpa_: 3dnp A: [174083]
    automated match to d1rkqa_
    complexed with edo, mg

Details for d3dnpa_

PDB Entry: 3dnp (more details), 1.85 Å

PDB Description: crystal structure of stress response protein yhax from bacillus subtilis
PDB Compounds: (A:) Stress response protein yhaX

SCOPe Domain Sequences for d3dnpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dnpa_ c.108.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
kqllalnidgallrsngkihqatkdaieyvkkkgiyvtlvtnrhfrsaqkiakslkldak
lithsgayiaekidapffekrisddhtfnivqvlesyqcnirllhekysignkkkvnsnl
lgkalihpsdpifypvqfveslsdllmdepvsapvievytehdiqhditetitkafpavd
virvndeklnivpkgvskeaglalvaselglsmddvvaighqyddlpmielaglgvamgn
avpeikrkadwvtrsndeqgvaymmkeyfrmqqrk

SCOPe Domain Coordinates for d3dnpa_:

Click to download the PDB-style file with coordinates for d3dnpa_.
(The format of our PDB-style files is described here.)

Timeline for d3dnpa_: