SCOPe 2.01: Domain d3dngb_: 3dng B:

Lineage for d3dngb_ (3dng B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Neutrophil collagenase (MMP-8) [55532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55533] (22 PDB entries)

8. Domain d3dngb_: 3dng B: [174080]
   automated match to d1i73a_
   complexed with axa, ca, zn

Details for d3dngb_

PDB Entry: 3dng, 2 Å

PDB Description: crystal structure of the complex between mmp-8 and a non-zinc chelating inhibitor

PDB Compounds: (B:) Neutrophil collagenase

SCOPe Domain Sequences for d3dngb_:

Sequence; same for both SEQRES and ATOM records:

>d3dngb_ d.92.1.11 (B:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d3dngb_:

• d3dngb_ is new in SCOPe 2.01-stable
  
• d3dngb_ appears in SCOPe 2.02
  
• d3dngb_ appears in the current release, SCOPe 2.08