Lineage for d1dxxc1 (1dxx C:9-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641474Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 641475Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 641476Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (9 proteins)
    Pfam PF00307
  6. 641494Protein Dystrophin [47584] (1 species)
    duplication: consists of tandem repeat of two CH domains
  7. 641495Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)
  8. 641500Domain d1dxxc1: 1dxx C:9-119 [17408]

Details for d1dxxc1

PDB Entry: 1dxx (more details), 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin
PDB Compounds: (C:) dystrophin

SCOP Domain Sequences for d1dxxc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxxc1 a.40.1.1 (C:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwq

SCOP Domain Coordinates for d1dxxc1:

Click to download the PDB-style file with coordinates for d1dxxc1.
(The format of our PDB-style files is described here.)

Timeline for d1dxxc1: