SCOPe 2.08: Domain d3dnga_: 3dng A:

Lineage for d3dnga_ (3dng A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Neutrophil collagenase (MMP-8) [55532] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55533] (24 PDB entries)

8. Domain d3dnga_: 3dng A: [174079]
   automated match to d1i73a_
   complexed with axa, ca, zn

Details for d3dnga_

PDB Entry: 3dng, 2 Å

PDB Description: crystal structure of the complex between mmp-8 and a non-zinc chelating inhibitor

PDB Compounds: (A:) Neutrophil collagenase

SCOPe Domain Sequences for d3dnga_:

Sequence; same for both SEQRES and ATOM records:

>d3dnga_ d.92.1.11 (A:) Neutrophil collagenase (MMP-8) {Human (Homo sapiens) [TaxId: 9606]}
mltpgnpkwertnltyrirnytpqlseaeveraikdafelwsvaspliftrisqgeadin
iafyqrdhgdnspfdgpngilahafqpgqgiggdahfdaeetwtntsanynlflvaahef
ghslglahssdpgalmypnyafretsnyslpqddidgiqaiyg

Timeline for d3dnga_:

• d3dnga_ first appeared in SCOPe 2.01
  
• d3dnga_ appears in SCOPe 2.07