SCOPe 2.06: Domain d3dmva_: 3dmv A:

Lineage for d3dmva_ (3dmv A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.3: Phage lysozyme [53981] (4 proteins)

6. Protein Phage T4 lysozyme [53982] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
   Uniprot P00720
   many mutant structures

8. Domain d3dmva_: 3dmv A: [174065]
   automated match to d212la_
   complexed with bme, cl, hed, po4; mutant

Details for d3dmva_

PDB Entry: 3dmv, 1.65 Å

PDB Description: free of ligand binding in the hydrophobic cavity of t4 lysozyme l99a mutant

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3dmva_:

Sequence; same for both SEQRES and ATOM records:

>d3dmva_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl

Timeline for d3dmva_:

• d3dmva_ first appeared in SCOPe 2.01
  
• d3dmva_ appears in SCOPe 2.05
  
• d3dmva_ appears in SCOPe 2.07
  
• d3dmva_ appears in the current release, SCOPe 2.08