Lineage for d3dmsa_ (3dms A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138768Protein automated matches [190072] (19 species)
    not a true protein
  7. 2138811Species Burkholderia pseudomallei [TaxId:28450] [188497] (1 PDB entry)
  8. 2138812Domain d3dmsa_: 3dms A: [174063]
    automated match to d1ai2a_

Details for d3dmsa_

PDB Entry: 3dms (more details), 1.65 Å

PDB Description: 1.65a crystal structure of isocitrate dehydrogenase from burkholderia pseudomallei
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d3dmsa_:

Sequence, based on SEQRES records: (download)

>d3dmsa_ c.77.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
yqhikvpeggdkitvnkdfslnvsdqpiipyiegdgtgfditpvmikvvdaavekayggk
kkihwmeiyagekatkvygpdvwlpeetlqvlkeyvvsikgplttpvgggirslnvalrq
eldlyvclrpiqyfkgvpspvrepektnmvifrensediyagiewaaeseqakkvikflq
eemgvkkirfpqtsgigikpvskegterlvrkaiqyaidndrksvtlvhkgnimkftega
frdagyalaqkefgaelidggpwmkfknpktgneivvkdsiadaflqqillrpaeydvia
tlnlngdyisdalaaqvggigiapganlsdsvamfeathgtapkyagkdyvnpgseilsa
emmlrhlgwteaadviisameksikqkrvtydfarlmegatqvscsgfgqvlienme

Sequence, based on observed residues (ATOM records): (download)

>d3dmsa_ c.77.1.1 (A:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
yqhikvpeggdkitvnkdfslnvsdqpiipyiegdgtgfditpvmikvvdaavekayggk
kkihwmeiyagekatkvygpdvwlpeetlqvlkeyvvsikgplttpvrslnvalrqeldl
yvclrpiqyfkgvpspvrepektnmvifrensediyagiewaaeseqakkvikflqeemg
vkkirfpqtsgigikpvskegterlvrkaiqyaidndrksvtlvhkgnimkftegafrda
gyalaqkefgaelidggpwmkfknpktgneivvkdsiadaflqqillrpaeydviatlnl
ngdyisdalaaqvggigiapganlsdsvamfeathgtapkyagkdyvnpgseilsaemml
rhlgwteaadviisameksikqkrvtydfarlmegatqvscsgfgqvlienme

SCOPe Domain Coordinates for d3dmsa_:

Click to download the PDB-style file with coordinates for d3dmsa_.
(The format of our PDB-style files is described here.)

Timeline for d3dmsa_: