SCOPe 2.07: Domain d3dmpc1: 3dmp C:1-213

Lineage for d3dmpc1 (3dmp C:1-213)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [188498] (1 PDB entry)

8. Domain d3dmpc1: 3dmp C:1-213 [174061]
   Other proteins in same PDB: d3dmpa2, d3dmpb2, d3dmpc2, d3dmpd2
   automated match to d1i5ea_

Details for d3dmpc1

PDB Entry: 3dmp, 2.6 Å

PDB Description: 2.6 a crystal structure of uracil phosphoribosyltransferase from burkholderia pseudomallei

PDB Compounds: (C:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d3dmpc1:

Sequence, based on SEQRES records:

>d3dmpc1 c.61.1.1 (C:1-213) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mkqdsrfpnlfildhpliqhklthmrdkdtstrtfrellreitllmgyeitrnlpittkr
vetplveidapviagkklaivpvlragvgmsdgllelipsarvghigvyraddhrpveyl
vrlpdledrifilcdpmvatgysaahaidvlkrrgvpgerlmflalvaapegvqvfqdah
pdvklyvasldshlddhayivpglgdagdrlfg

Sequence, based on observed residues (ATOM records):

>d3dmpc1 c.61.1.1 (C:1-213) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mkqdsrfpnlfildhpliqhklthmrdkdtstrtfrellreitllmgyeitrnlpittkr
vetplveidapviagkklaivpvlragvgmsdgllelipsarvghigvyraddrpveylv
rlpdledrifilcdpmvatgysaahaidvlkrrgvpgerlmflalvaapegvqvfqdahp
dvklyvasldshlddhayivpglgdagdrlfg

Timeline for d3dmpc1:

• d3dmpc1 first appeared in SCOPe 2.01, called d3dmpc_
  
• d3dmpc1 appears in SCOPe 2.06
  
• d3dmpc1 appears in the current release, SCOPe 2.08