SCOPe 2.06: Domain d1dxxb1: 1dxx B:9-119

Lineage for d1dxxb1 (1dxx B:9-119)

Root: SCOPe 2.06
Class a: All alpha proteins [46456] (289 folds)
Fold a.40: CH domain-like [47575] (3 superfamilies)
core: 4 helices: bundle
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)
Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
Pfam PF00307
Protein Dystrophin [47584] (1 species)
duplication: consists of tandem repeat of two CH domains
Species Human (Homo sapiens) [TaxId:9606] [47585] (1 PDB entry)
Domain d1dxxb1: 1dxx B:9-119 [17406]

Details for d1dxxb1

PDB Entry: 1dxx (more details), 2.6 Å

PDB Description: n-terminal actin-binding domain of human dystrophin

PDB Compounds: (B:) dystrophin

SCOPe Domain Sequences for d1dxxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxxb1 a.40.1.1 (B:9-119) Dystrophin {Human (Homo sapiens) [TaxId: 9606]}
dsyeredvqkktftkwvnaqfskfgkqhienlfsdlqdgrrlldllegltgqklpkekgs
trvhalnnvnkalrvlqnnnvdlvnigstdivdgnhkltlgliwniilhwq

SCOPe Domain Coordinates for d1dxxb1:

Click to download the PDB-style file with coordinates for d1dxxb1.
(The format of our PDB-style files is described here.)

Timeline for d1dxxb1: