Lineage for d3dmia_ (3dmi A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691317Protein automated matches [190113] (17 species)
    not a true protein
  7. 2691363Species Phaeodactylum tricornutum [TaxId:2850] [188813] (1 PDB entry)
  8. 2691364Domain d3dmia_: 3dmi A: [174056]
    automated match to d1cyja_
    complexed with hec, mg

Details for d3dmia_

PDB Entry: 3dmi (more details), 1.5 Å

PDB Description: crystallization and structural analysis of cytochrome c6 from the diatom phaeodactylum tricornutum at 1.5 a resolution
PDB Compounds: (A:) cytochrome c6

SCOPe Domain Sequences for d3dmia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dmia_ a.3.1.1 (A:) automated matches {Phaeodactylum tricornutum [TaxId: 2850]}
gdvgageqifnancaachaggqnvimpektlekealdqylaggrteksiisqvtggknam
pafggrlsdeeianvaayvlasaeagw

SCOPe Domain Coordinates for d3dmia_:

Click to download the PDB-style file with coordinates for d3dmia_.
(The format of our PDB-style files is described here.)

Timeline for d3dmia_: