Lineage for d3dm6a_ (3dm6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060948Protein automated matches [190156] (4 species)
    not a true protein
  7. 2060973Species Human (Homo sapiens) [TaxId:9606] [187237] (38 PDB entries)
  8. 2061017Domain d3dm6a_: 3dm6 A: [174053]
    automated match to d1fkna_
    complexed with 757, ipa

Details for d3dm6a_

PDB Entry: 3dm6 (more details), 2.6 Å

PDB Description: Beta-secretase 1 complexed with statine-based inhibitor
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d3dm6a_:

Sequence, based on SEQRES records: (download)

>d3dm6a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiig
gidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlp
kkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfr
itilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavs
achvhdefrtaavegpfvtldmedcgyn

Sequence, based on observed residues (ATOM records): (download)

>d3dm6a_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqls
styrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnweg
ilglayaeiarpddslepffdslvkqthvpnlfslqlcgavggsmiiggidhslytgslw
ytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavksik
aasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqylrpv
esqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefrtaavegp
fvtldcgyn

SCOPe Domain Coordinates for d3dm6a_:

Click to download the PDB-style file with coordinates for d3dm6a_.
(The format of our PDB-style files is described here.)

Timeline for d3dm6a_: