Lineage for d3dl4b_ (3dl4 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134065Protein Acetylcholinesterase [53476] (5 species)
  7. 2134094Species Mouse (Mus musculus) [TaxId:10090] [53479] (29 PDB entries)
  8. 2134108Domain d3dl4b_: 3dl4 B: [174046]
    automated match to d1maac_
    complexed with p6g

Details for d3dl4b_

PDB Entry: 3dl4 (more details), 2.5 Å

PDB Description: Non-Aged Form of Mouse Acetylcholinesterase Inhibited by Tabun- Update
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d3dl4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dl4b_ c.69.1.1 (B:) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]}
edpqllvrvrggqlrgirlkapggpvsaflgipfaeppvgsrrfmppepkrpwsgvldat
tfqnvcyqyvdtlypgfegtemwnpnrelsedclylnvwtpyprpasptpvliwiygggf
ysgaasldvydgrflaqvegavlvsmnyrvgtfgflalpgsreapgnvglldqrlalqwv
qeniaafggdpmsvtlfgesagaasvgmhilslpsrslfhravlqsgtpngpwatvsage
arrratllarlvgcppggaggndteliaclrtrpaqdlvdhewhvlpqesifrfsfvpvv
dgdflsdtpealintgdfqdlqvlvgvvkdegsyflvygvpgfskdneslisraqflagv
rigvpqasdlaaeavvlhytdwlhpedpthlrdamsavvgdhnvvcpvaqlagrlaaqga
rvyayifehrastltwplwmgvphgyeiefifglpldpslnytteerifaqrlmkywtnf
artgdpndprdskspqwppyttaaqqyvslnlkplevrrglraqtcafwnrflpkll

SCOPe Domain Coordinates for d3dl4b_:

Click to download the PDB-style file with coordinates for d3dl4b_.
(The format of our PDB-style files is described here.)

Timeline for d3dl4b_: