Lineage for d3dksc_ (3dks C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854195Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 1854196Protein Disulfide-bond formation facilitator (DsbA) [100954] (3 species)
    the insert subdomain is a 4-helical bundle
  7. 1854228Species Shigella flexneri [TaxId:623] [188867] (1 PDB entry)
  8. 1854231Domain d3dksc_: 3dks C: [174042]
    automated match to d1a23a_

Details for d3dksc_

PDB Entry: 3dks (more details), 1.9 Å

PDB Description: DsbA substrate complex
PDB Compounds: (C:) Thiol:disulfide interchange protein dsbA

SCOPe Domain Sequences for d3dksc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dksc_ c.47.1.13 (C:) Disulfide-bond formation facilitator (DsbA) {Shigella flexneri [TaxId: 623]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylse

SCOPe Domain Coordinates for d3dksc_:

Click to download the PDB-style file with coordinates for d3dksc_.
(The format of our PDB-style files is described here.)

Timeline for d3dksc_: