Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.13: DsbA-like [100953] (4 proteins) contains an all-alpha subdomain insertion |
Protein Disulfide-bond formation facilitator (DsbA) [100954] (3 species) the insert subdomain is a 4-helical bundle |
Species Shigella flexneri [TaxId:623] [188867] (1 PDB entry) |
Domain d3dksc_: 3dks C: [174042] automated match to d1a23a_ |
PDB Entry: 3dks (more details), 1.9 Å
SCOPe Domain Sequences for d3dksc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dksc_ c.47.1.13 (C:) Disulfide-bond formation facilitator (DsbA) {Shigella flexneri [TaxId: 623]} aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad tvkylse
Timeline for d3dksc_: