SCOPe 2.08: Domain d3dkma1: 3dkm A:1273-1342

Lineage for d3dkma1 (3dkm A:1273-1342)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.19: Mib/herc2 domain-like [159034] (1 family)

5. Family b.34.19.1: Mib/herc2 domain [159035] (1 protein)
   Pfam PF06701

6. Protein E3 ubiquitin-protein ligase hectd1 [159036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159037] (2 PDB entries)
   Uniprot Q9ULT8 1268-1340

8. Domain d3dkma1: 3dkm A:1273-1342 [174037]
   Other proteins in same PDB: d3dkma2
   automated match to d2dk3a1

Details for d3dkma1

PDB Entry: 3dkm, 1.6 Å

PDB Description: crystal structure of the hectd1 cph domain

PDB Compounds: (A:) E3 ubiquitin-protein ligase HECTD1

SCOPe Domain Sequences for d3dkma1:

Sequence; same for both SEQRES and ATOM records:

>d3dkma1 b.34.19.1 (A:1273-1342) E3 ubiquitin-protein ligase hectd1 {Human (Homo sapiens) [TaxId: 9606]}
lkymvpgarvtrgldwkwrdqdgspqgegtvtgelhngwidvtwdaggsnsyrmgaegkf
dlklapgydp

Timeline for d3dkma1:

• d3dkma1 first appeared in SCOPe 2.01, called d3dkma_
  
• d3dkma1 appears in SCOPe 2.07