Lineage for d3dkka_ (3dkk A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134240Protein Butyryl cholinesterase [102612] (1 species)
  7. 2134241Species Human (Homo sapiens) [TaxId:9606] [102613] (6 PDB entries)
  8. 2134245Domain d3dkka_: 3dkk A: [174036]
    automated match to d1p0ia_
    complexed with cl, na, nag, so4

Details for d3dkka_

PDB Entry: 3dkk (more details), 2.31 Å

PDB Description: Aged Form of Human Butyrylcholinesterase Inhibited by Tabun
PDB Compounds: (A:) cholinesterase

SCOPe Domain Sequences for d3dkka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkka_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]}
diiiatkngkvrgmqltvfggtvtaflgipyaqpplgrlrfkkpqsltkwsdiwnatkya
nsccqnidqsfpgfhgsemwnpntdlsedclylnvwipapkpknatvliwiygggfqtgt
sslhvydgkflarvervivvsmnyrvgalgflalpgnpeapgnmglfdqqlalqwvqkni
aafggnpksvtlfgexagaasvslhllspgshslftrailqsgsfnapwavtslyearnr
tlnlakltgcsreneteiikclrnkdpqeillneafvvpygtplsvnfgptvdgdfltdm
pdillelgqfkktqilvgvnkdegtaflvygapgfskdnnsiitrkefqeglkiffpgvs
efgkesilfhytdwvddqrpenyrealgdvvgdynficpaleftkkfsewgnnaffyyfe
hrssklpwpewmgvmhgyeiefvfglplerrdqytkaeeilsrsivkrwanfakygnpqe
tqnqstswpvfksteqkyltlntestrimtklraqqcrfwtsffpkv

SCOPe Domain Coordinates for d3dkka_:

Click to download the PDB-style file with coordinates for d3dkka_.
(The format of our PDB-style files is described here.)

Timeline for d3dkka_: