Lineage for d3dkib1 (3dki B:1-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140145Species Mycobacterium tuberculosis [TaxId:1773] [188598] (7 PDB entries)
  8. 2140151Domain d3dkib1: 3dki B:1-316 [174035]
    Other proteins in same PDB: d3dkib2
    automated match to d2bhsa1
    complexed with na

Details for d3dkib1

PDB Entry: 3dki (more details), 2.1 Å

PDB Description: 2.1 A X-ray structure of CysM (Rv1336) from Mycobacterium tuberculosis an O-phosphoserine dependent cysteine synthase
PDB Compounds: (B:) Cysteine synthase B

SCOPe Domain Sequences for d3dkib1:

Sequence, based on SEQRES records: (download)

>d3dkib1 c.79.1.0 (B:1-316) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
marydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsaaeggsntavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfv
aglgttgtlmgtgrflrehvanvkivaaeprygegvyalrnmdegfvpelydpeiltary
svgavdavrrtrelvhtegifagistgavlhaalgvgagalaageradialvvadagwky
lstgayagslddaeta

Sequence, based on observed residues (ATOM records): (download)

>d3dkib1 c.79.1.0 (B:1-316) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
marydsllqalgntplvglqrlsprwddgrdgphvrlwakledrnptgsikdrpavrmie
qaeadgllrpgatileptsgntgislamaarlkgyrlicvmpentsverrqllelygaqi
ifsatavatakelaatnpswvmlyqygnpantdshycgtgpelladlpeithfvaglgtt
gtlmgtgrflrehvanvkivaaepvpelydpeiltarysvgavdavrrtrelvhtegifa
gistgavlhaalgvgagalaageradialvvadagwkylstgayagslddaeta

SCOPe Domain Coordinates for d3dkib1:

Click to download the PDB-style file with coordinates for d3dkib1.
(The format of our PDB-style files is described here.)

Timeline for d3dkib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dkib2
View in 3D
Domains from other chains:
(mouse over for more information)
d3dkia_