Lineage for d3dkdb_ (3dkd B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204903Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1204904Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1205133Protein automated matches [190032] (10 species)
    not a true protein
  7. 1205134Species Acanthamoeba polyphaga mimivirus [TaxId:212035] [188891] (24 PDB entries)
  8. 1205154Domain d3dkdb_: 3dkd B: [174031]
    automated match to d2b8pa1
    complexed with gdp, mg; mutant

Details for d3dkdb_

PDB Entry: 3dkd (more details), 1.9 Å

PDB Description: crystal structure of the mimivirus ndk +kpn-n62l-r107g triple mutant complexed with gdp
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3dkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkdb_ d.58.6.1 (B:) automated matches {Acanthamoeba polyphaga mimivirus [TaxId: 212035]}
lqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyfn
dlcdfmvsgpiisivyegtdaiskirrlqgntnplasapgtirgdlandigenlihasds
edsavdeisiwfp

SCOPe Domain Coordinates for d3dkdb_:

Click to download the PDB-style file with coordinates for d3dkdb_.
(The format of our PDB-style files is described here.)

Timeline for d3dkdb_: