Lineage for d1qagb2 (1qag B:152-256)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325181Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2325182Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2325183Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2325239Protein Utrophin [47582] (1 species)
  7. 2325240Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)
  8. 2325246Domain d1qagb2: 1qag B:152-256 [17403]

Details for d1qagb2

PDB Entry: 1qag (more details), 3 Å

PDB Description: Actin binding region of the dystrophin homologue utrophin
PDB Compounds: (B:) utrophin actin binding region

SCOPe Domain Sequences for d1qagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qagb2 a.40.1.1 (B:152-256) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
sekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspierl
ehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpq

SCOPe Domain Coordinates for d1qagb2:

Click to download the PDB-style file with coordinates for d1qagb2.
(The format of our PDB-style files is described here.)

Timeline for d1qagb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qagb1