Lineage for d1qagb2 (1qag B:152-256)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3533Fold a.40: Calponin-homology domain, CH-domain [47575] (1 superfamily)
  4. 3534Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (1 family) (S)
  5. 3535Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (4 proteins)
  6. 3554Protein Utrophin [47582] (1 species)
  7. 3555Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)
  8. 3561Domain d1qagb2: 1qag B:152-256 [17403]

Details for d1qagb2

PDB Entry: 1qag (more details), 3 Å

PDB Description: Actin binding region of the dystrophin homologue utrophin

SCOP Domain Sequences for d1qagb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qagb2 a.40.1.1 (B:152-256) Utrophin {Human (Homo sapiens)}
sekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspierl
ehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpq

SCOP Domain Coordinates for d1qagb2:

Click to download the PDB-style file with coordinates for d1qagb2.
(The format of our PDB-style files is described here.)

Timeline for d1qagb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qagb1