SCOPe 2.08: Domain d1qagb2: 1qag B:152-256

Lineage for d1qagb2 (1qag B:152-256)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein Utrophin [47582] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47583] (2 PDB entries)

8. Domain d1qagb2: 1qag B:152-256 [17403]

Details for d1qagb2

PDB Entry: 1qag, 3 Å

PDB Description: Actin binding region of the dystrophin homologue utrophin

PDB Compounds: (B:) utrophin actin binding region

SCOPe Domain Sequences for d1qagb2:

Sequence; same for both SEQRES and ATOM records:

>d1qagb2 a.40.1.1 (B:152-256) Utrophin {Human (Homo sapiens) [TaxId: 9606]}
sekillswvrqttrpysqvnvlnfttswtdglafnavlhrhkpdlfswdkvvkmspierl
ehafskaqtylgieklldpedvavrlpdkksiimyltslfevlpq

Timeline for d1qagb2:

• d1qagb2 first appeared (with stable ids) in SCOP 1.55
  
• d1qagb2 appears in SCOPe 2.07