| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species) PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries) |
| Domain d3dkca1: 3dkc A:1051-1360 [174029] Other proteins in same PDB: d3dkca2 automated match to d1r0pa_ complexed with atp, cl, mg |
PDB Entry: 3dkc (more details), 1.52 Å
SCOPe Domain Sequences for d3dkca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dkca1 d.144.1.7 (A:1051-1360) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk
slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir
nethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmy
dkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf
ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyv
hvnatyvnvk
Timeline for d3dkca1: