Lineage for d3dkca1 (3dkc A:1051-1360)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981716Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981717Species Human (Homo sapiens) [TaxId:9606] [103301] (67 PDB entries)
  8. 2981722Domain d3dkca1: 3dkc A:1051-1360 [174029]
    Other proteins in same PDB: d3dkca2
    automated match to d1r0pa_
    complexed with atp, cl, mg

Details for d3dkca1

PDB Entry: 3dkc (more details), 1.52 Å

PDB Description: structure of met receptor tyrosine kinase in complex with atp
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3dkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkca1 d.144.1.7 (A:1051-1360) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
vhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcavk
slnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfir
nethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfglardmy
dkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntf
ditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfigehyv
hvnatyvnvk

SCOPe Domain Coordinates for d3dkca1:

Click to download the PDB-style file with coordinates for d3dkca1.
(The format of our PDB-style files is described here.)

Timeline for d3dkca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3dkca2