Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Abelsone tyrosine kinase (abl) [56166] (2 species) PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase |
Species Mouse (Mus musculus) [TaxId:10090] [56167] (16 PDB entries) |
Domain d3dk3b_: 3dk3 B: [174024] automated match to d1opjb_ complexed with so4, sx7; mutant |
PDB Entry: 3dk3 (more details), 2.02 Å
SCOPe Domain Sequences for d3dk3b_:
Sequence, based on SEQRES records: (download)
>d3dk3b_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} dkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmke ikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissame ylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahagakfpikwtapesla ynkfsiksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelm racwqwnpsdrpsfaeihqafetmfqessisde
>d3dk3b_ d.144.1.7 (B:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} dkwemertditmkhklgggqygevyegvwkkysltvavktlmeveeflkeaavmkeikhp nlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqissameylek knfihrdlaarnclvgenhlvkvadfglsrlmtgdtftahagakfpikwtapeslaynkf siksdvwafgvllweiatygmspypgidpsqvyellekdyrmerpegcpekvyelmracw qwnpsdrpsfaeihqafetmfqessisde
Timeline for d3dk3b_: